General Information

  • ID:  hor000004
  • Uniprot ID:  P43145
  • Protein name:  Adrenomedullin
  • Gene name:  ADM
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  Expressed in adrenal glands, lung, kidney, heart, spleen, duodenum and submandibular glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0031700 adrenomedullin receptor binding
  • GO BP:  GO:0001570 vasculogenesis; GO:0001666 response to hypoxia; GO:0001843 neural tube closure; GO:0002026 regulation of the force of heart contraction; GO:0002031 G protein-coupled receptor internalization; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0008209 androgen metabolic process; GO:0008283 cell population proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0010033 response to organic substance; GO:0010460 positive regulation of heart rate; GO:0019933 cAMP-mediated signaling; GO:0031100 animal organ regeneration; GO:0031102 neuron projection regeneration; GO:0031623 receptor internalization; GO:0032496 response to lipopolysaccharide; GO:0032868 response to insulin; GO:0035809 regulation of urine volume; GO:0042475 odontogenesis of dentin-containing tooth; GO:0042594 response to starvation; GO:0043065 positive regulation of apoptotic process; GO:0043116 negative regulation of vascular permeability; GO:0045766 positive regulation of angiogenesis; GO:0045906 negative regulation of vasoconstriction; GO:0048589 developmental growth; GO:0051384 response to glucocorticoid; GO:0060670 branching involved in labyrinthine layer morphogenesis; GO:0060712 spongiotrophoblast layer development; GO:0097084 vascular associated smooth muscle cell development; GO:1990410 adrenomedullin receptor signaling pathway; GO:2001214 positive regulation of vasculogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
  • Length:  50
  • Propeptide:  MKLVSIALMLLGSLAVLGADTARLDTSSQFRKKWNKWALSRGKRELQASSSYPTGLVDEKTVPTQTLGLQDKQSTSSTPQASTQSTAHIRVKRYRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYGRRRRRSLPEVLRARTVESSQEQTHSAPASPAHQDISRVSRL
  • Signal peptide:  MKLVSIALMLLGSLAVLGADT
  • Modification:  T50 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasodilating effects on cerebral vessels and exacerbate ischemic brain damage ;inhibits Adipogenesis;Pain Neuropeptide
  • Mechanism:  The PI3K/Akt/GSK3β Signaling Pathway Is Involved in AM-Induced Heat Hyperalgesia.
  • Cross BBB:  YES
  • Target:  Calcrl, Ramp2
  • Target Unid:  Q63118, Q9JHJ1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1.05±0.04 minutes; /63 seconds ( PubMed ID: 8542672 )

Structure

  • Disulfide bond:  14-19
  • Structure ID:  AF-P43145-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P43145-F1.pdbhor000004_AF2.pdbhor000004_ESM.pdb

Physical Information

Mass: 660664 Formula: C242H382N76O76S5
Absent amino acids: EVW Common amino acids: QG
pI: 10.07 Basic residues: 9
Polar residues: 20 Hydrophobic residues: 7
Hydrophobicity: -115.4 Boman Index: -14487
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 27.4
Instability Index: 4476.6 Extinction Coefficient cystines: 4595
Absorbance 280nm: 93.78

Literature

  • PubMed ID:  7690563
  • Title:  Molecular cloning and biological activities of rat adrenomedullin, a hypotensive peptide.
  • PubMed ID:  8542672
  • Title:  Haemodynamic responses to rat adrenomedullin in anaesthetized spontaneously hypertensive rats